Protein Info for EX28DRAFT_3391 in Enterobacter asburiae PDN3

Annotation: Gamma-aminobutyrate permease and related permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 28 to 45 (18 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details amino acids 347 to 364 (18 residues), see Phobius details amino acids 371 to 397 (27 residues), see Phobius details amino acids 417 to 435 (19 residues), see Phobius details amino acids 441 to 460 (20 residues), see Phobius details PF00324: AA_permease" amino acids 27 to 465 (439 residues), 440.5 bits, see alignment E=7.4e-136 PF13520: AA_permease_2" amino acids 31 to 446 (416 residues), 147.4 bits, see alignment E=6.3e-47

Best Hits

Swiss-Prot: 94% identical to CYCA_ECOL6: D-serine/D-alanine/glycine transporter (cycA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K11737, D-serine/D-alanine/glycine transporter (inferred from 99% identity to enc:ECL_00601)

MetaCyc: 94% identical to D-serine/alanine/glycine:H+symporter (Escherichia coli K-12 substr. MG1655)
RXN0-5130; RXN0-5201; RXN0-5202; RXN0-5203; TRANS-RXN-62A; TRANS-RXN-62B

Predicted SEED Role

"D-serine/D-alanine/glycine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>EX28DRAFT_3391 Gamma-aminobutyrate permease and related permeases (Enterobacter asburiae PDN3)
MVDQVKVAATEEATSEQSLRRNLTNRHIQLIAIGGAIGTGLFMGSGKTISLAGPSIIFVY
MIIGFMLFFVMRAMGELLLSNLEYKSFSDFASDLLGPWAGYFTGWTYWFCWVVTGMADVV
AITAYAQFWFPGLSDWVASLAVIVLLLSLNLATVKMFGEMEFWFAMIKIVAIVGLIVVGL
VMVLTHFQSPTGVQASFTHLWNDGGWFPKGISGFFAGFQIAVFAFVGIELVGTTAAETKD
PEKSLPRAINSIPLRIIMFYVFALIIIMSVTPWSSVVPTKSPFVELFVLVGLPAAASLIN
FVVLTSAASSANSGVFSTSRMLFGLAQEGVAPSAFAKLSKRAVPAKGLTFSCMCLLGGVV
MLYVNPSVIGAFTMITTVSAILFMFVWTIILCSYLVYRKQRPHLHEKSIYKMPLGKLMCW
VCMAFFVFVLVLLTLEDDTRQALIVTPLWFIALGLGWVFIGKKRMAGVR