Protein Info for EX28DRAFT_3335 in Enterobacter asburiae PDN3

Annotation: anaerobic c4-dicarboxylate membrane transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 6 to 39 (34 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 131 to 157 (27 residues), see Phobius details amino acids 164 to 190 (27 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 261 to 277 (17 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details amino acids 328 to 346 (19 residues), see Phobius details amino acids 357 to 381 (25 residues), see Phobius details amino acids 408 to 432 (25 residues), see Phobius details PF03605: DcuA_DcuB" amino acids 5 to 365 (361 residues), 522.8 bits, see alignment E=2.4e-161 TIGR00770: transporter, anaerobic C4-dicarboxylate uptake (Dcu) family" amino acids 5 to 433 (429 residues), 653.8 bits, see alignment E=6.8e-201

Best Hits

Swiss-Prot: 71% identical to DCUA_WOLSU: Anaerobic C4-dicarboxylate transporter DcuA (dcuA) from Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W)

KEGG orthology group: K07791, anaerobic C4-dicarboxylate transporter DcuA (inferred from 98% identity to ent:Ent638_0325)

MetaCyc: 62% identical to C4-dicarboxylate transporter DcuA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-106; TRANS-RXN-106A; TRANS-RXN-106B; TRANS-RXN-299; TRANS-RXN-379

Predicted SEED Role

"C4-dicarboxylate transporter DcuA"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>EX28DRAFT_3335 anaerobic c4-dicarboxylate membrane transporter family protein (Enterobacter asburiae PDN3)
MFGAELVIVLLAIYLGARLGGIGIGFAGGLGVLVLTLIFQIKPGAIPFDVIEIIMAVIAA
IAAMQVAGGMDYLVSLAERMLRRHPKYITFLAPLVTWFMTILAGTGHTAFSTLPVITEVA
KEQGIRPSRPLSIAVVASQIAITASPISAAVVFFAGILEPMGVSYLTLLAICIPVTLIAV
MITAVLCNFLGAELKDDPVYQERLAKGEVRLRGSQVFELKPHAKRSVLLFLIGIVAVMFY
ATAISDTVGLIQNPVLPRNEAIVVFMLTIATLISITCKIDTSEVLNASTFKSGMSACVCV
LGVAWLGDTFVKAHISDIQTVAGDLLHNYPWLLAVVLFFAATLLYSQAATTKALMPAALM
LGVTPLTAIASFAAVSALFVLPTYPTLLAAVEMDDTGSTRIGKYVFNHAFLIPGVVAISL
CVILGFIIGGVVL