Protein Info for EX28DRAFT_3333 in Enterobacter asburiae PDN3

Annotation: Thiol:disulfide interchange protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 174 to 201 (28 residues), see Phobius details amino acids 214 to 238 (25 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details amino acids 294 to 324 (31 residues), see Phobius details amino acids 336 to 358 (23 residues), see Phobius details amino acids 370 to 388 (19 residues), see Phobius details amino acids 394 to 414 (21 residues), see Phobius details amino acids 422 to 439 (18 residues), see Phobius details PF11412: DsbD_N" amino acids 29 to 138 (110 residues), 122.2 bits, see alignment E=3.6e-39 PF02683: DsbD_TM" amino acids 176 to 388 (213 residues), 272.7 bits, see alignment E=5.7e-85 PF13386: DsbD_2" amino acids 178 to 367 (190 residues), 29.2 bits, see alignment E=2.5e-10 PF00085: Thioredoxin" amino acids 461 to 564 (104 residues), 31.7 bits, see alignment E=3.8e-11 PF13899: Thioredoxin_7" amino acids 466 to 542 (77 residues), 47.7 bits, see alignment E=4.1e-16 PF13098: Thioredoxin_2" amino acids 469 to 568 (100 residues), 53.3 bits, see alignment E=9.8e-18

Best Hits

KEGG orthology group: K04084, thiol:disulfide interchange protein DsbD [EC: 1.8.1.8] (inferred from 92% identity to enc:ECL_00534)

Predicted SEED Role

"Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase (EC 1.8.1.8)" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange (EC 1.8.1.8)

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.8

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (571 amino acids)

>EX28DRAFT_3333 Thiol:disulfide interchange protein (Enterobacter asburiae PDN3)
MAQRFLTLILLLCSTSAFAGLFDAPGRSNFIPADQAFVFDFQQNQHDLSLTWQVKEGYYL
YRKQVSITPAQANVGALQMPAGEWHEDEFYGKSEIYRQRLSVPVTVNQADKGATLTVTYQ
GCADAGFCYPPETKVVPLSEVKAAAAIPPLPSGERARVRGEGEGEAASDLPFSALWALLI
GIGIAFTPCVLPMYPLISGIVLGGKQRLSTARALLLAFIYVQGMALTYTALGLVVAAAGL
QFQAALQHPYVLIGLSAVFILLALSMFGLFTLQLPSSLQTRLTLMSNRQQGGSAGGVFAM
GAIAGLICSPCTTAPLSAILLYIAQSGNMWLGGGTLYLYALGMGLPLILVTVFGNRLLPK
SGPWMETVKTAFGFVILALPVFLLERIIGDVWGLRLWAMLGVAFFAWAFIVSLGAKKPWM
RLVQILLLAAALVSVRPLQDWAFGTPVGQTQAHLNFTQIKNVDELNSALAEAKGKAVMLD
LYADWCVACKEFEKYTFSDPQVQSVLKETVLLQANVTANNAQDKALLKQLNVLGLPTILF
FNQQGQEQPEQRVTGFMDAAAFSAHLRNRQP