Protein Info for EX28DRAFT_3231 in Enterobacter asburiae PDN3

Annotation: putative RNA-binding protein, YhbY family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 TIGR00253: putative RNA-binding protein, YhbY family" amino acids 16 to 110 (95 residues), 142.2 bits, see alignment E=3.1e-46 PF01985: CRS1_YhbY" amino acids 16 to 99 (84 residues), 102.9 bits, see alignment E=4.7e-34

Best Hits

Swiss-Prot: 94% identical to YHBY_ECO57: RNA-binding protein YhbY (yhbY) from Escherichia coli O157:H7

KEGG orthology group: K07574, RNA-binding protein (inferred from 99% identity to enc:ECL_04559)

Predicted SEED Role

"FIG004454: RNA binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (110 amino acids)

>EX28DRAFT_3231 putative RNA-binding protein, YhbY family (Enterobacter asburiae PDN3)
MNRFQSQRKQKYTMNLSTKQKQHLKGLAHPLKPVVMLGNNGLTEGVLAEIEQALEHHELI
KVKIASEDRDTKNLIVEAIVRETGACNVQVIGKTLVLYRPSKERKISLPR