Protein Info for EX28DRAFT_3182 in Enterobacter asburiae PDN3

Annotation: 2-hydroxy-3-oxopropionate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF03807: F420_oxidored" amino acids 4 to 94 (91 residues), 32 bits, see alignment E=3.1e-11 TIGR01505: 2-hydroxy-3-oxopropionate reductase" amino acids 4 to 294 (291 residues), 507.3 bits, see alignment E=5.8e-157 PF02826: 2-Hacid_dh_C" amino acids 4 to 117 (114 residues), 27.9 bits, see alignment E=3e-10 PF03446: NAD_binding_2" amino acids 4 to 163 (160 residues), 181.4 bits, see alignment E=2.7e-57 PF14833: NAD_binding_11" amino acids 166 to 284 (119 residues), 138.8 bits, see alignment E=2.1e-44

Best Hits

Swiss-Prot: 95% identical to GARR_ECOL6: 2-hydroxy-3-oxopropionate reductase (garR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00042, 2-hydroxy-3-oxopropionate reductase [EC: 1.1.1.60] (inferred from 98% identity to enc:ECL_04514)

MetaCyc: 95% identical to tartronate semialdehyde reductase (Escherichia coli K-12 substr. MG1655)
2-hydroxy-3-oxopropionate reductase. [EC: 1.1.1.60]

Predicted SEED Role

"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>EX28DRAFT_3182 2-hydroxy-3-oxopropionate reductase (Enterobacter asburiae PDN3)
MTLKVGFIGLGIMGKPMSKNLIKAGYSLVVSDHNPQAVAEVIAAGAETATTAKAIAEQCD
VIITMLPNSPHVKEVALGENGIIDGAKPGLVLIDMSSIAPLASREISEALKAKGVDMLDA
PVSGGEPKAIDGTLSVMVGGDKAVFDRYYDLMKAMAGSVVHTGDIGAGNVTKLANQVIVA
LNIAAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPMVMDRNFKPGFRIDLHIK
DLANALDTSHGVGAQLPLTAAVMEMMQALRADGLGTADHSAIACYYEKLAKVEVAR