Protein Info for EX28DRAFT_3158 in Enterobacter asburiae PDN3

Annotation: Na+/serine symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 45 to 70 (26 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 214 to 238 (25 residues), see Phobius details amino acids 291 to 315 (25 residues), see Phobius details amino acids 326 to 351 (26 residues), see Phobius details amino acids 362 to 378 (17 residues), see Phobius details PF00375: SDF" amino acids 17 to 396 (380 residues), 217.8 bits, see alignment E=1.3e-68

Best Hits

Swiss-Prot: 92% identical to SSTT_SALA4: Serine/threonine transporter SstT (sstT) from Salmonella agona (strain SL483)

KEGG orthology group: K07862, serine/threonine transporter (inferred from 97% identity to enc:ECL_04490)

MetaCyc: 91% identical to serine/threonine:Na+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-22449; RXN0-4083

Predicted SEED Role

"Sodium:dicarboxylate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>EX28DRAFT_3158 Na+/serine symporter (Enterobacter asburiae PDN3)
MSTQSSGLFARLAQGSLVKQILVGLVLGILLAMVSKPAAEATGLLGTLFVGALKAVAPVL
VLMLVMASIANHQHGQKTNIRPILFLYLLGTFSAALTAVVFSFLFPSTLHLTSAAGDITP
PSGIVEVLRGLLMSMVSNPITALMSGNYIGILVWAIGLGFALRHGNDTTKNLVNDLSNAV
TFMVKLVIRFAPIGIFGLVSSTLATTGFDALWGYAQLLVVLVGCMLLVALVINPLLVFWQ
IRRNPYPLVLTCLRESGVYAFFTRSSAANIPVNMALAEKLNLDRDTYSVSIPLGATVNMA
GAAITITVLTLAAVHTLGIPVDLPTALLLSVVASLCACGASGVAGGSLLLIPLACNMFGI
PNEIAMQVVAVGFIIGVLQDSCETALNSSTDVLFTAAACQAEDARLAKNALRS