Protein Info for EX28DRAFT_3157 in Enterobacter asburiae PDN3

Annotation: integral membrane protein, TerC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 227 to 228 (2 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 265 to 282 (18 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details TIGR03718: integral membrane protein, TerC family" amino acids 7 to 313 (307 residues), 396.8 bits, see alignment E=3.7e-123 PF03741: TerC" amino acids 81 to 282 (202 residues), 176.6 bits, see alignment E=2e-56

Best Hits

Swiss-Prot: 86% identical to ALX_SALTI: Putative membrane-bound redox modulator Alx (alx) from Salmonella typhi

KEGG orthology group: None (inferred from 97% identity to enc:ECL_04489)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>EX28DRAFT_3157 integral membrane protein, TerC family (Enterobacter asburiae PDN3)
MHSVGTPMLWGGFAVVVLIMLAIDLFLQGRRGAHGMSIKQAAAWSLVWVTLSLLFCAAFW
WYLASTEGRAVADPQALAFITGYLIEKALAVDNVFVWLMLFSYFAVPAALQRRVLVYGVL
GAIILRTIMIFAGSWLITQFEWLLYVFGAFLLFTGVKMALAKEDGSAIGDRPLVKWIRGH
LRMTDKIESEHFFVRKNGLLFATPLLLVLILVELSDVIFAVDSIPAIFAVTTDPFIVLTS
NLFAILGLRAMYFLLAGAAERFSMLKYGLSVILVFIGIKMLIVDFYHIPIAISLGVVFGI
LIVTLIINTWVNRQHDKKQQVE