Protein Info for EX28DRAFT_3149 in Enterobacter asburiae PDN3

Annotation: ABC-type sugar transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 PF00005: ABC_tran" amino acids 20 to 162 (143 residues), 105.3 bits, see alignment E=4.1e-34 amino acids 274 to 422 (149 residues), 76.5 bits, see alignment E=3.3e-25

Best Hits

Swiss-Prot: 90% identical to LSRA_ENT38: Autoinducer 2 import ATP-binding protein LsrA (lsrA) from Enterobacter sp. (strain 638)

KEGG orthology group: K10558, AI-2 transport system ATP-binding protein (inferred from 94% identity to enc:ECL_04482)

MetaCyc: 63% identical to Autoinducer-2 ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-454 [EC: 7.6.2.13]

Predicted SEED Role

"Autoinducer 2 (AI-2) ABC transport system, fused AI2 transporter subunits and ATP-binding component" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (495 amino acids)

>EX28DRAFT_3149 ABC-type sugar transport system, ATPase component (Enterobacter asburiae PDN3)
MTSLLDARNISKQFSGVPVLKGIDFTLLAGQVHALMGGNGAGKSTLMKIIAGVETPDSGE
LSVEGQSYARLTPLQAHRLGIYLVPQEPLLFPNLTVRENILFRLPRERDLEKRLAEKLQQ
LQCQLNLDAAASTLEVADQQMVEILRGLMRNARILILDEPTASLTPGETERLFRQIRALQ
ALGVGIVFISHKLPEIRMLSSHVSVMRDGAVVLSGETAQFDDSALIAAMTPVSRGKSLSD
TQKLWLALPGNRRTQPQDFPVLRVDDLTGEGFIDLSLEIYAGEIVGLAGLVGSGRTELAE
TLYGLRPVRGGRVWLENQEITDDPVSSRLEKGLVYLPEDRQASGLFLDAPIRWNTVALNE
PSIWQQRKRESAVVERYHRALGIKLNHADQNVRTLSGGNQQKVLLARCLEANPLLLIVDE
PTRGVDVSARADIYQLIKSVAAQNVAVLMISSDLDEFPGLADRVLVMHQGVLSGELPRHA
VSLDRMMALAFGGQS