Protein Info for EX28DRAFT_3136 in Enterobacter asburiae PDN3

Annotation: Siderophore-interacting protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF08021: FAD_binding_9" amino acids 20 to 131 (112 residues), 105.6 bits, see alignment E=2e-34 PF04954: SIP" amino acids 139 to 253 (115 residues), 92 bits, see alignment E=3.9e-30

Best Hits

Swiss-Prot: 71% identical to YQJH_ECOLI: NADPH-dependent ferric-chelate reductase (yqjH) from Escherichia coli (strain K12)

KEGG orthology group: K07229, (no description) (inferred from 87% identity to enc:ECL_04454)

MetaCyc: 71% identical to NADPH-dependent ferric-chelate reductase (Escherichia coli K-12 substr. MG1655)
RXN0-6555 [EC: 1.16.1.9]; 1.16.1.9 [EC: 1.16.1.9]; 1.16.1.9 [EC: 1.16.1.9]

Predicted SEED Role

"iron-chelator utilization protein" in subsystem Ton and Tol transport systems

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.16.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>EX28DRAFT_3136 Siderophore-interacting protein (Enterobacter asburiae PDN3)
MASIRYPQRVRNDLRFRELTVLRVERPSAGFQRIVLGGEQLEGFSSRGFDDHTKVFFPAP
GAVFVPPVVTDEGIEWGDGVRPQTRDYTPLYDEANHELVLDFFVHDGGIASRWAVEAKAG
DRLTIGGPRGSLVVPEDYAWQLYVCDESGMPALRRRLESIAKLPVRPEIHAVVTVGDESY
KDYLAHLSEFNITWVVGHSEQAVADHLAALTVPGEDYFIWLTGEGKVVKTLSRQFETDAI
DQQLVRASAYWHAK