Protein Info for EX28DRAFT_3111 in Enterobacter asburiae PDN3

Annotation: Phage tail sheath protein FI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF22671: Gp18_domIII_N" amino acids 26 to 86 (61 residues), 56.7 bits, see alignment E=3.8e-19 PF04984: Phage_sheath_1" amino acids 113 to 279 (167 residues), 112.5 bits, see alignment E=3e-36 PF17482: Phage_sheath_1C" amino acids 280 to 382 (103 residues), 77.6 bits, see alignment E=1.1e-25

Best Hits

Swiss-Prot: 81% identical to TSP_BPP2: Tail sheath protein (FI) from Escherichia phage P2

KEGG orthology group: K06907, (no description) (inferred from 90% identity to ent:Ent638_3482)

Predicted SEED Role

"Phage tail sheath monomer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>EX28DRAFT_3111 Phage tail sheath protein FI (Enterobacter asburiae PDN3)
MSDFHHGVEVIEINDGTRTISTVSTAIIGMVCTASDADDKTFPLNEPVLITNVQNAIAKA
GKAGTLSASLQAIADQCKPVVVVVRVAEGTAETPEEARKQTVSNIIGTTDENGKYTGLKA
LLTAKTVTGVKPRILGVPGLDSQEVATALAAMCQSLRAFGYVSAWGCKTISEAINYRKNF
SQRELMVIHPDFLAWDTTTNATTTAWATARALGLRAKIDQTIGWHKTLSNVGVNGVTGVS
ASVSWDLQEQATDANLLNQAGVTTLIRNDGFKFWGNRTCSDDPLFVFENYTRTAQVLADT
MAEAHAWAMDKPITPTLIRDIVSGINAKFRELKTNGYIVDGSCWYDPDSNDATTLKAGKL
YIDYDYTPVPPLENLTLRQRITDTYLADLSDSVNS