Protein Info for EX28DRAFT_3076 in Enterobacter asburiae PDN3

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02900: LigB
  • amino acids 24 to 239 (216 residues), 76.5 bits, E=9.7e-26

Best Hits

Swiss-Prot: 88% identical to YGID_ECOLI: 4,5-DOPA dioxygenase extradiol (ygiD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to enc:ECL_04366)

MetaCyc: 88% identical to 4,5-DOPA dioxygenase extradiol (Escherichia coli K-12 substr. MG1655)
Stizolobate synthase. [EC: 1.13.11.29]

Predicted SEED Role

"Uncharacterized protein ygiD"

MetaCyc Pathways

• betalamic acid biosynthesis (2/3 steps found)
• superpathway of betalain biosynthesis (13/27 steps found)

KEGG Metabolic Maps

• Tyrosine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.29

Protein Sequence (262 amino acids)

>EX28DRAFT_3076 Uncharacterized conserved protein (Enterobacter asburiae PDN3)
MTSSRMPALFLGHGSPMNVLEDNVYTRAWRHLGETLPRPKAIVVVSAHWFTRGTGVTAME
APKTIHDFGGFPQALYDTHYPAPGSPELAQKLVELLAPVSVTLDKEAWGFDHGSWGVLIK
MYPDADIPMVQLSIDSTKPAAWHLEMGRKLATLRDEGIMLVASGNVVHNLRTARWHGENT
PYPWATSFNDYVKANLTWQGPAEEHPLVNYLDHEGGSLSNPTPEHFLPLLYVLGAWDGQE
PVTIPVDGIEMGSLSMLSVQVG