Protein Info for EX28DRAFT_3005 in Enterobacter asburiae PDN3

Annotation: citrate lyase, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01588: citrate (pro-3S)-lyase, beta subunit" amino acids 3 to 289 (287 residues), 473.6 bits, see alignment E=8.9e-147 PF03328: HpcH_HpaI" amino acids 6 to 224 (219 residues), 267.8 bits, see alignment E=6.2e-84 PF15617: C-C_Bond_Lyase" amino acids 197 to 289 (93 residues), 38.6 bits, see alignment E=7.4e-14

Best Hits

Swiss-Prot: 75% identical to CITE_KLEPN: Citrate lyase subunit beta (citE) from Klebsiella pneumoniae

KEGG orthology group: K01644, citrate lyase subunit beta / citryl-CoA lyase [EC: 4.1.3.34 4.1.3.6] (inferred from 99% identity to enc:ECL_04296)

MetaCyc: 75% identical to citrate lyase beta subunit (Klebsiella pneumoniae)
Citryl-CoA lyase. [EC: 4.1.3.34, 4.1.3.6]

Predicted SEED Role

"Citrate lyase beta chain (EC 4.1.3.6)" (EC 4.1.3.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.6

Use Curated BLAST to search for 4.1.3.34 or 4.1.3.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>EX28DRAFT_3005 citrate lyase, beta subunit (Enterobacter asburiae PDN3)
MSKLRRSMLFLPGANAAMLSTAFIYRPDSIMFDLEDAVALREKDTARMLVFHALQHPMYQ
DIETVVRINPLSTPFGLLDLEAAVRAGVDVIRLPKTDTPDDIYELEGHLERIEQECGREV
GSTRVMAAIESAIGVINAVAIARSSPRLIGIALAAFDYVMDMQTERGDGTELFYARCAVL
HAARAAGIDAFDVVWSDVNDEAGFLREVDLIRKMGFNGKSLINPRQIDLLHNAYAPTQDE
VDHAKRVIEAAEEGERNGLGVVSLNGKMVDAPIINHAQVVLERAAASGVRR