Protein Info for EX28DRAFT_2988 in Enterobacter asburiae PDN3

Annotation: pilus retraction protein PilT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR01420: twitching motility protein" amino acids 3 to 325 (323 residues), 416.7 bits, see alignment E=4e-129 PF00437: T2SSE" amino acids 77 to 269 (193 residues), 162.1 bits, see alignment E=7.8e-52

Best Hits

Swiss-Prot: 73% identical to YGGR_ECOLI: Uncharacterized protein YggR (yggR) from Escherichia coli (strain K12)

KEGG orthology group: K02669, twitching motility protein PilT (inferred from 83% identity to ent:Ent638_3356)

Predicted SEED Role

"Twitching motility protein PilT" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>EX28DRAFT_2988 pilus retraction protein PilT (Enterobacter asburiae PDN3)
MDVEEIVALSVKHNVSDLHLCSDSPPRWRRLGRLEPAPFPPPDVGALLKAWLNDEQQGTW
WAKGQVDFAATVTGGQRLRGSAFKQMSGISVTLRLLPRSCPQLSSLGAPRAIPELLCNDA
GLILVTGATGSGKSTTLAAMVDFLNHHADGHILTLEDPVEFIYQSERCLIQQREIGQHSP
SFAEALRSALRQDPDVILLGELRDSETIRLALTAAETGHLVLATLHTRGASQAIERLVDT
FPAQEKDPVRNQLAGSLRAVLAQKLLPDLQGGRVALYELLVNTAAAANLIREGKTWQLPG
IIQTGQQAGMQNFDQSLAERRAQGRL