Protein Info for EX28DRAFT_2956 in Enterobacter asburiae PDN3
Annotation: glycine cleavage system H protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 95% identical to GCSH_SHIFL: Glycine cleavage system H protein (gcvH) from Shigella flexneri
KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 97% identity to enc:ECL_04231)MetaCyc: 95% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)
MetaCyc Pathways
- glycine biosynthesis II (3/3 steps found)
- glycine cleavage (3/3 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (129 amino acids)
>EX28DRAFT_2956 glycine cleavage system H protein (Enterobacter asburiae PDN3) MSNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPDVGTTVSAGDDCAV AESVKAASDIYAPVSGEIVAVNDALSDSPELVNSEPYEGGWIFKIKASDESQVAALLDAT AYEALLEDE