Protein Info for EX28DRAFT_2861 in Enterobacter asburiae PDN3

Annotation: phosphopyruvate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 TIGR01060: phosphopyruvate hydratase" amino acids 4 to 428 (425 residues), 678.1 bits, see alignment E=2.1e-208 PF03952: Enolase_N" amino acids 4 to 134 (131 residues), 192.3 bits, see alignment E=3.7e-61 PF00113: Enolase_C" amino acids 144 to 429 (286 residues), 473.3 bits, see alignment E=3.1e-146

Best Hits

Swiss-Prot: 98% identical to ENO_SALPK: Enolase (eno) from Salmonella paratyphi A (strain AKU_12601)

KEGG orthology group: K01689, enolase [EC: 4.2.1.11] (inferred from 99% identity to enc:ECL_04113)

MetaCyc: 96% identical to enolase (Escherichia coli K-12 substr. MG1655)
Phosphopyruvate hydratase. [EC: 4.2.1.11]

Predicted SEED Role

"Enolase (EC 4.2.1.11)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Serine-glyoxylate cycle (EC 4.2.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.11

Use Curated BLAST to search for 4.2.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>EX28DRAFT_2861 phosphopyruvate hydratase (Enterobacter asburiae PDN3)
MSKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFL
GKGVLKAVGAVNGPIAQAILGKDAKDQAGIDKIMIDLDGTENKSNFGANAILAVSLANAK
AAAAAKGMPLFEHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAKSLK
EAVRMGSEVFHNLAKVLKAKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKD
ITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEDLTKQYPIVSIEDGLDESDWAG
FAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIVNSILIKFNQIGSLTETLAAIKMAK
DAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEKA
PYNGLKEIKGQA