Protein Info for EX28DRAFT_2825 in Enterobacter asburiae PDN3

Annotation: ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF00005: ABC_tran" amino acids 18 to 167 (150 residues), 126.6 bits, see alignment E=1.1e-40

Best Hits

Swiss-Prot: 38% identical to FPUD_BACAN: Petrobactin import ATP-binding protein FpuD (fpuD) from Bacillus anthracis

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 96% identity to enc:ECL_04074)

MetaCyc: 36% identical to iron(III) hydroxamate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-11-RXN [EC: 7.2.2.16]; TRANS-RXN-297 [EC: 7.2.2.16]; TRANS-RXN-298 [EC: 7.2.2.16]

Predicted SEED Role

"ABC transporter (iron.B12.siderophore.hemin) , ATP-binding component"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34 or 7.2.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>EX28DRAFT_2825 ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components (Enterobacter asburiae PDN3)
MSICAENITWKVGKKVIVNDVSLKVSRGETVGLLGPNGCGKSSLLRILAGLRRPDAGCVT
LDGQDISRIAKKQLARRVAFVEQHGMTDANMRVRDVVKLGRIPHHSAFSNWSNHDDETVT
AALQRVDMLDKSDQGWLSLSGGERQRVHIARALAQTPTEILLDEPTNHLDIHHQMQLMQL
ISELPVTSIVAIHDLNHASMFCDSLIVMQKGQIVATGTPQDILSESLLWDVFRVKTKIEI
SPFHGKKHIHFIV