Protein Info for EX28DRAFT_2803 in Enterobacter asburiae PDN3

Annotation: [NiFe] hydrogenase maturation protein HypF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 738 PF00708: Acylphosphatase" amino acids 7 to 87 (81 residues), 56.3 bits, see alignment E=8e-19 TIGR00143: carbamoyltransferase HypF" amino acids 8 to 729 (722 residues), 894.4 bits, see alignment E=2.7e-273 PF07503: zf-HYPF" amino acids 105 to 138 (34 residues), 61 bits, see alignment (E = 1.9e-20) amino acids 155 to 186 (32 residues), 52.6 bits, see alignment (E = 8.1e-18) PF01300: Sua5_yciO_yrdC" amino acids 206 to 369 (164 residues), 139.3 bits, see alignment E=2.5e-44 PF17788: HypF_C" amino acids 389 to 483 (95 residues), 107.2 bits, see alignment E=1.5e-34 PF22521: HypF_C_2" amino acids 496 to 725 (230 residues), 209.2 bits, see alignment E=2.1e-65

Best Hits

Swiss-Prot: 71% identical to HYPF_ECOLI: Carbamoyltransferase HypF (hypF) from Escherichia coli (strain K12)

KEGG orthology group: K04656, hydrogenase maturation protein HypF (inferred from 78% identity to ent:Ent638_3185)

MetaCyc: 71% identical to carbamoyl--[HypE] ligase (Escherichia coli K-12 substr. MG1655)
6.2.1.-

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypF" in subsystem NiFe hydrogenase maturation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (738 amino acids)

>EX28DRAFT_2803 [NiFe] hydrogenase maturation protein HypF (Enterobacter asburiae PDN3)
MCSNGVQLRVRGKVQGVGFRPFVWQLAQALQLTGDVCNDGEGVLVRLAGNGGAFTARLHQ
DCPPLARIDHVETQPFTWAQVPEDFTIRHSAGGAMDTQIVPDAATCPACLAEMRDPGERR
YRYPFINCTHCGPRFTIIRAMPYDRPATSMAAFPLCVPCEAEYRNPADRRFHAQPVACPD
CGPALEWRAGDNTAAREGALSAAVAMLKSGGIVAVKGLGGFHLVCDARNPQAVATLRARK
QRPAKPLAVMIPNADGVPEAIQTLLRSSAAPIVLTPKASLPGFPEGIAPGLDCIGIMLPA
NPLQHLLMMDCQRPLVMTSGNLSGRPPAMTNQQALDELGDIADGFLLHNRDILQRMDDSV
MDRDGAMLRRARGFVPDAVALPAGFENIPAMLCTGAEMKNTFCLVRGSQAVLSQHFGDLG
DEGVEAQWRGALSLMQRIYAFQPKRVVCDAHPGYRTQQWAQAQGVPVETVLHHHAHAAAC
LAENGWPREGGDVIALTLDGIGMGENGALWGGECLRVSYLACERLGGLPAVALPGGDLAA
RQPWRNLLAHCLAFVPDWQQYPETRAVQRQNWPLLATAIRRGINAPQASSCGRLFDAVAC
ALGIETQSWEGEAACRLEALASQCAGVDHPVTLSVDNLALFWQQWLAWQADPCERAWAFH
DALAKGLAELAALHARRLSLSTICLSGGVLHNRLLRARLRHYLSDFTLLFPSRLPAGDGA
ISFGQAAIAAARSCSQRT