Protein Info for EX28DRAFT_2802 in Enterobacter asburiae PDN3

Annotation: high-affinity nickel-transporter, HoxN/HupN/NixA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 80 to 105 (26 residues), see Phobius details amino acids 119 to 144 (26 residues), see Phobius details amino acids 187 to 211 (25 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 259 to 286 (28 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details PF03824: NicO" amino acids 40 to 326 (287 residues), 339.3 bits, see alignment E=9.6e-106 TIGR00802: transition metal uptake transporter, Ni2+-Co2+ transporter (NiCoT) family" amino acids 44 to 321 (278 residues), 399.7 bits, see alignment E=3.6e-124

Best Hits

KEGG orthology group: K07241, high-affinity nickel-transport protein (inferred from 94% identity to enc:ECL_04049)

Predicted SEED Role

"HoxN/HupN/NixA family nickel/cobalt transporter" in subsystem Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>EX28DRAFT_2802 high-affinity nickel-transporter, HoxN/HupN/NixA family (Enterobacter asburiae PDN3)
MLRLLRNEPRAALLLLALVMANLLAWGWAWHAFSGSTALMAASLLAWCYGLRHAVDADHI
AAIDTVTRKMMQQGKRPSGVGAWFSLGHSTIVVLASIAIAATATAFQKNMEWFHETGSLI
GTAVSATFLLVMALVNMVILRGVWRSFQALKQGRPVQGDITLPAQGGVMNWLFGKTFRLV
NKSWQMYLVGFLFGLGFDTATEIGVLGISAASASSGMSVWSIMVFPALFASGMALVDTLD
NLLMVGAYGWAFNKPQRKLYYNMTITGTSVVVALFIGGLEALGLLMDKFALSGGVWDLIG
AVNDNLGNAGFVVVGLFVACWLISMVNYRWRGYDALVVRS