Protein Info for EX28DRAFT_2705 in Enterobacter asburiae PDN3

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details PF17152: CHASE8" amino acids 44 to 145 (102 residues), 104.9 bits, see alignment E=2.5e-34 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 246 to 403 (158 residues), 105.2 bits, see alignment E=1.5e-34 PF00990: GGDEF" amino acids 248 to 402 (155 residues), 133.4 bits, see alignment E=6.7e-43

Best Hits

Swiss-Prot: 67% identical to DGCN_ECOLI: Diguanylate cyclase DgcN (dgcN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to enc:ECL_03935)

MetaCyc: 67% identical to diguanylate cyclase DgcN (Escherichia coli K-12 substr. MG1655)
Diguanylate kinase. [EC: 2.7.7.65]

Predicted SEED Role

"Inner membrane protein YfiN"

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.65

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>EX28DRAFT_2705 diguanylate cyclase (GGDEF) domain (Enterobacter asburiae PDN3)
MDKDFTSTPRPTFKRTLRRNSMISVIITMTLIWLLLCFASVVTLKQYAQKNLELTGATMS
HSLEASLVFNDSLAANETLAALGKQGQFAVAEVINAHKKRFAYWSWNPEDNNDTLGALVS
RWLFPVPVAQPIMHNGATIGEIRLTARDSLIGHFIWMSFAVLTGCILFATVVALTITQSL
HHGMVTALQNITDVVHDVRTNRNFSRRVKDGRIEEFHQFGEDFNSLLDEMEEWQLKLQAK
NAQLLRTAMHDPLTGLANRAAFRNSIAALMNDPSAKTNSALLFLDGDNFKFINDTWGHAA
GDCVLIEVASRMMEFGDKRHQAYRLGGDEFAMVLYGVHSELEVQHICAALSQQFIRPFDL
HNGQKASMSLSIGFALAWENASVEALLERADRNMYQVKNQRTKTTS