Protein Info for EX28DRAFT_2654 in Enterobacter asburiae PDN3

Annotation: Alpha/beta hydrolase of unknown function (DUF1100)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF06500: FrsA-like" amino acids 1 to 414 (414 residues), 726.3 bits, see alignment E=5.1e-223

Best Hits

Swiss-Prot: 92% identical to Y765_ENT38: UPF0255 protein Ent638_0765 (Ent638_0765) from Enterobacter sp. (strain 638)

KEGG orthology group: K11750, esterase FrsA [EC: 3.1.-.-] (inferred from 97% identity to enc:ECL_01069)

Predicted SEED Role

"Fermentation/respiration switch protein"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>EX28DRAFT_2654 Alpha/beta hydrolase of unknown function (DUF1100) (Enterobacter asburiae PDN3)
MTQANLTETLFKPRFKHPETSTLVRRFNPGTQPAVQSALDGKNVPHWYRMINRLMWIWRG
IDPREILDVQARIVMSEAERTDSELYDTVVGYRGGNWIYEWSKQAMLWQQKASQEEDATR
SGKQWLHAANLYGIAAYPHLKGDELAEQAQALANRAYQEAAQRLPGRMRELEFTISGGAS
VTGFLHMPEGEGPFPTVLMCGGLDSLQIDYYSLYERYFAPKGIAMLTLDMPSIGFSSKWK
LTQDSSLLHQHALKALENIPWVDHTRVAAFGFRFGANVAVRLAYIESSRLKAVACLGPVV
HALLSDPARQGSVPEMYLDVLASRLGMHDASDEALRVELNRYSLKTQGLLGRRCPTPMLS
GFWKNDPFSPEEESRLITSSSADGKLLEVPFSPVYQNFDKSLKEITRWIAQRLC