Protein Info for EX28DRAFT_2615 in Enterobacter asburiae PDN3

Annotation: drug resistance transporter, EmrB/QacA subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 transmembrane" amino acids 17 to 39 (23 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 87 to 113 (27 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 341 to 360 (20 residues), see Phobius details amino acids 366 to 385 (20 residues), see Phobius details amino acids 481 to 500 (20 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 22 to 495 (474 residues), 419.3 bits, see alignment E=1e-129 PF07690: MFS_1" amino acids 25 to 418 (394 residues), 183.1 bits, see alignment E=7.4e-58 PF00083: Sugar_tr" amino acids 28 to 191 (164 residues), 23.1 bits, see alignment E=3.3e-09

Best Hits

Swiss-Prot: 42% identical to FARB_NEIGO: Fatty acid resistance protein FarB (farB) from Neisseria gonorrhoeae

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 61% identity to rso:RSc1852)

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (514 amino acids)

>EX28DRAFT_2615 drug resistance transporter, EmrB/QacA subfamily (Enterobacter asburiae PDN3)
MSTLVIDNQPPSLKGGMLWIGALVLAMANFLAVLNMTIANVTQPNMAGALGAGTSQGTWI
ITAYAVAEAITVPLSGWLTTRFGGVRVFSVSVFMFGIFSLLCGLSTSLGMLLLMRVFQGM
AGGPLMALSQTLLLRIFPKEKSMQATGLWAMTTLLAPVIGPVLGGWICDHYSWSWVFIIN
VPMAIAFSVVAWSVLKIFEDTLINNSIDIVGFILLVIWVGALQIMLDEGKDLDWFASEEI
CVLAIIACIGFLSFCIWELTAEHPIVDIRVFRHRGFSASMFVLALAFGCFFGLNVLTPLW
LQYNLGYTTTWAGIVVAWGGLLQVVFSPVAANLSNKIDPRILIFFGCAWLGLDTFWRSYA
TTDMDYWSICVPLLFMGVGMPLYYVPITGLAMGSVDETEMASAAGLMNFVRTLSGAFATS
LVTTSWQDQRYIAHDKLASVVDHTGDLSHYISSAPQQGGQFVRELFDKMVNSQSMMLSTN
NLMMSIGVIFFIAAFAIALAPKPSRVVDAASVGH