Protein Info for EX28DRAFT_2584 in Enterobacter asburiae PDN3

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF02639: DUF188" amino acids 17 to 144 (128 residues), 165 bits, see alignment E=3.4e-53

Best Hits

Swiss-Prot: 93% identical to Y858_ENT38: UPF0178 protein Ent638_0858 (Ent638_0858) from Enterobacter sp. (strain 638)

KEGG orthology group: K09768, hypothetical protein (inferred from 98% identity to enc:ECL_01145)

Predicted SEED Role

"Protein YaiI" in subsystem CBSS-562.2.peg.5158 SK3 including

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>EX28DRAFT_2584 Uncharacterized protein conserved in bacteria (Enterobacter asburiae PDN3)
MAIWVDADACPNVIKEILFRAAERVQMPLTLVANQNIRVPPSRFIRSLRVPAGFDVADNE
IVRLCSAEDLVITADIPLAAEVLEKGAAALNPRGERYSPSTIREKLTMRDFMDTMRASGV
QTGGPDSLSQRDRQQFAAELDKWLLEVKRRTA