Protein Info for EX28DRAFT_2538 in Enterobacter asburiae PDN3

Annotation: AmpG-like permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 48 to 68 (21 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 131 (25 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 225 to 250 (26 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details amino acids 382 to 406 (25 residues), see Phobius details amino acids 427 to 448 (22 residues), see Phobius details amino acids 460 to 484 (25 residues), see Phobius details PF13000: Acatn" amino acids 16 to 164 (149 residues), 41.7 bits, see alignment E=6.2e-15 PF07690: MFS_1" amino acids 17 to 366 (350 residues), 105.1 bits, see alignment E=3.7e-34 TIGR00901: AmpG-like permease" amino acids 25 to 363 (339 residues), 416.3 bits, see alignment E=6e-129

Best Hits

Swiss-Prot: 84% identical to AMPG_ECO57: Anhydromuropeptide permease (ampG) from Escherichia coli O157:H7

KEGG orthology group: K08218, MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG (inferred from 96% identity to enc:ECL_01191)

MetaCyc: 84% identical to muropeptide:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-226; TRANS-RXN0-258

Predicted SEED Role

"AmpG permease"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (491 amino acids)

>EX28DRAFT_2538 AmpG-like permease (Enterobacter asburiae PDN3)
MSSHYLRIFQQPKSAILLILGFASGLPLALTSGTLQAWMTVENIDLKTIGFFSLVGQAYV
FKFLWSPVMDRYTPPFLGRRRGWLVMTQILLLLAIAAMGFLEPTTQLRWMAALAVVIAFC
SASQDIVFDAWKTDVLPAEERGAGAAISVLGYRLGMLVSGGLALWLADRYLGWQGMYWLM
AALLIPCIIATLFAPEPSDVIPVPRSLEQAVAEPLRDFFGRNNAWLILLLIVLYKLGDAF
AMSLTTTFLIRGVGFDAGEVGVVNKTLGLFATIVGALYGGVLMQRLTLFRALLIFGILQG
ASNAGYWLLSITDKHTISMAAAVFFENLCGGMGTAAFVALLMTLCNKSFSATQFALLSAL
SAVGRVYVGPIAGWFVEAHGWPTFYLFSVVAAVPGILLLLVCRQTLEYTQRTEHFMPRTE
YHRAYRFALRLLMAGCIALALWLVVLIINASTSLVLPFEALLLDAGALLAIAGILIGGLL
DFMALRKTQMT