Protein Info for EX28DRAFT_2510 in Enterobacter asburiae PDN3

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 5 to 23 (19 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details amino acids 152 to 178 (27 residues), see Phobius details PF19700: DUF6198" amino acids 2 to 183 (182 residues), 103.3 bits, see alignment E=7.6e-34

Best Hits

Swiss-Prot: 38% identical to Y522_HAEIN: Uncharacterized protein HI_0522 (HI_0522) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 92% identity to enc:ECL_01219)

Predicted SEED Role

"FIG00761799: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>EX28DRAFT_2510 Predicted membrane protein (Enterobacter asburiae PDN3)
MVRRLLQLYVGLGLYGLSTAMFIRSDLGVDPWDVFHLGVGMQLGMTIGTVIILVGAAVLL
LWIPLRQMPGLGTISNVICIGLAADASMALIPELDSLAVRIAFLVSGIVMNAIATSMYIG
AGFGPGPRDGLMTGIHARLGWSIRSVRTSIEVSVLLIGCVLGGTFGVGTVLYALTIGPLI
QLCLPWFRQKPRIAEIPQPERVV