Protein Info for EX28DRAFT_2495 in Enterobacter asburiae PDN3

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00529: CusB_dom_1" amino acids 38 to 361 (324 residues), 59.8 bits, see alignment E=4e-20 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 40 to 375 (336 residues), 288.4 bits, see alignment E=3e-90 PF16576: HlyD_D23" amino acids 60 to 293 (234 residues), 49.1 bits, see alignment E=9.2e-17 PF13437: HlyD_3" amino acids 175 to 290 (116 residues), 31.6 bits, see alignment E=4.5e-11

Best Hits

Swiss-Prot: 87% identical to ACRA_ECO57: Multidrug efflux pump subunit AcrA (acrA) from Escherichia coli O157:H7

KEGG orthology group: K03585, membrane fusion protein (inferred from 95% identity to enc:ECL_01234)

MetaCyc: 87% identical to multidrug efflux pump membrane fusion lipoprotein AcrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-356; TRANS-RXN-357; TRANS-RXN-359; TRANS-RXN-360; TRANS-RXN0-592

Predicted SEED Role

"Membrane fusion protein of RND family multidrug efflux pump" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>EX28DRAFT_2495 RND family efflux transporter, MFP subunit (Enterobacter asburiae PDN3)
MNKNRGLTPLAVVLMLSGSLALTGCDDKPAQQGAQQAPEVGVVTLKSEPLQITTELPGRT
NAYRIAEVRPQVSGIILKRNFTEGGDVKAGESLYQIDPATYQASYESAKGDLAKAQAAAK
IAQLTLNRYQKLLGTKYISQQDYDTALADAQQANAAVVAAKAAVETARINLAYTKVTSPI
SGRIGKSSVTEGALVQNGQTNALATVQQLDPIYVDVTQSSNDFLRLKQELANGTLKQENG
KAKVELITNDGIKFPQEGTLEFSDVTVDQTTGSITLRAIFPNPDKNLLPGMFVRARLEEG
TNPTALLVPQQGVTRTPRGDASALVVGADDKVETRNITATQAIGDKWLVTEGLKDGDRVI
VTGLQKVRPGAQVKAQEVKSDDKQQASAAGQSEQTKS