Protein Info for EX28DRAFT_2466 in Enterobacter asburiae PDN3

Annotation: Short-chain dehydrogenases of various substrate specificities

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00106: adh_short" amino acids 3 to 191 (189 residues), 142.3 bits, see alignment E=2e-45 PF08659: KR" amino acids 5 to 175 (171 residues), 42.8 bits, see alignment E=8.1e-15 PF13561: adh_short_C2" amino acids 11 to 191 (181 residues), 104 bits, see alignment E=1.4e-33

Best Hits

Swiss-Prot: 88% identical to YBBO_ECOL6: Uncharacterized oxidoreductase YbbO (ybbO) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 94% identity to enc:ECL_01260)

MetaCyc: 88% identical to NADP+-dependent aldehyde reductase YbbO (Escherichia coli K-12 substr. MG1655)
Alcohol dehydrogenase (NADP(+)). [EC: 1.1.1.2]; 1.1.1.- [EC: 1.1.1.2]

Predicted SEED Role

"Putative NAD(P)-dependent oxidoreductase EC-YbbO"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>EX28DRAFT_2466 Short-chain dehydrogenases of various substrate specificities (Enterobacter asburiae PDN3)
MQKSVLITGCSSGIGLESALELKRQGFRVLAACRKPDDVERMNGLGFTGVLLDMDSPESV
ERAADEVIALTDNRLYGLFNNAGYGVYGPLDTLSRETLEKQFSTNFFGVHQLTMRLLPAM
LPHGEGRIVMTSSVMGLISTPGRGAYAASKYALEAWSDALRMELRHSGIKVSLIEPGPIR
TRFTENVNQTQADKPIENPGIAARFTLGPEAVVAKVRHAFESEHPKMRYPVTLVTHAVGW
LKRLLPGRMMDKILHG