Protein Info for EX28DRAFT_2423 in Enterobacter asburiae PDN3

Annotation: Predicted Zn-dependent hydrolases of the beta-lactamase fold

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF13483: Lactamase_B_3" amino acids 93 to 303 (211 residues), 59.9 bits, see alignment E=4.6e-20 PF12706: Lactamase_B_2" amino acids 109 to 303 (195 residues), 142.3 bits, see alignment E=2.4e-45

Best Hits

KEGG orthology group: None (inferred from 94% identity to enc:ECL_03154)

Predicted SEED Role

"Outer membrane protein romA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>EX28DRAFT_2423 Predicted Zn-dependent hydrolases of the beta-lactamase fold (Enterobacter asburiae PDN3)
MIIASAASLPFVLNAGFGQPPQGEQLTEVEASPQYREGKFHNTLPTPGYNGDKNMLVATW
DFLTKKTENARPAQPLPLVKTDLASLPLEQDTLVWLGHSSWYLQLAGKRILIDPVLSNYA
APFSFLNKAFAGEYPWRAESMPEIDLLIISHDHYDHLDYATIRALLPKVKRVVTPLGVGS
HLRYWGMKPEIIDERDWNQSVRISDELTVHVLPARHFSGRGIKRDRTLWGSFMFVTPEQK
VYYSGDSGYGPHFKAIGEQFDGVDVAIMENGQYDQDWKYIHMLPEETAQASVDLNAKAVV
PGHNGRFVLAKHTWNDPLIQLAKASKDKNYRLLTPALGEPVRVNDATQTFRAWWE