Protein Info for EX28DRAFT_2383 in Enterobacter asburiae PDN3

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 746 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF07715: Plug" amino acids 51 to 165 (115 residues), 97.9 bits, see alignment E=4.8e-32 TIGR01783: TonB-dependent siderophore receptor" amino acids 52 to 746 (695 residues), 450.4 bits, see alignment E=6.4e-139 PF00593: TonB_dep_Rec" amino acids 281 to 700 (420 residues), 187.3 bits, see alignment E=9.5e-59

Best Hits

Swiss-Prot: 80% identical to FEPA_ECOLI: Ferrienterobactin receptor (fepA) from Escherichia coli (strain K12)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 98% identity to enc:ECL_03117)

MetaCyc: 80% identical to ferric enterobactin outer membrane transporter (Escherichia coli K-12 substr. MG1655)
RXN0-1682

Predicted SEED Role

"TonB-dependent receptor; Outer membrane receptor for ferric enterobactin and colicins B, D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (746 amino acids)

>EX28DRAFT_2383 TonB-dependent siderophore receptor (Enterobacter asburiae PDN3)
MNKKIHSLALLVNLGIYGVALPAVADDKTASAQHEDTMVITAAEQNLQAPGVSTITADEI
RKNPPARDVAEIIRTMPGVNLTGNSTSGQRGNNRQIDIRGMGPENTLILIDGKPVTSRNS
IRLGWRGERDTRGDTGWVPPEMIERIEVIRGPAAARYGNGAAGGVVNIITKKFDDQWHGS
WNTYLNAPEHKDEGSTKRTNFSLSGPLGGDFSFRMFGNLDKTQADAWDINQGHQSDRTGA
YANTLPAGREGVENKDINGVVRWDFAPMQSLEFEAGYSRQNNLYAGDTQNTNNDNALVKK
NYGKETNRIYRQNFAVTWNGGWDNGITTSSWAQYEHTRNSRLGEGLAGGLEGLFNSNKFT
DTDLADVMLHSEINLPIDLLVNQNLTLGTEWNQQRMKDSTSFTQTQQGGTIPGMSDDRSP
YTSAEIFSLFAENNMELTDSTMLTPALRFDHHTIVGNNWSPSLNLSQGLGDDFTLKMGIA
RAYKAPSLYQTNPNYLLYSKGQGCYASGDGVGCYMMGNDDLKAETSINKEIGLEWKHDGW
LAGVTWFRNDYRNKIEAGYAPIGQTSTGKVTTDIYQWENVPKAVVEGLEGSLNVPVSDTI
NWTNNITYMLQSKNKETGDRLSIIPEYTLNSTLSWQVHQDVSLQSTFTWYGKQQPKKYNY
KGQPVTGSEKDEVSPYSIVGLSATWDMTKNVSLTGGVDNVFDKRQWRAGNAQTTGNATTG
AYMYGAGAYTYNEPGRTWYMSVNTRF