Protein Info for EX28DRAFT_2335 in Enterobacter asburiae PDN3

Annotation: lipoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 TIGR00510: lipoyl synthase" amino acids 21 to 321 (301 residues), 539.3 bits, see alignment E=1.3e-166 PF16881: LIAS_N" amino acids 26 to 73 (48 residues), 28 bits, see alignment 2.6e-10 PF04055: Radical_SAM" amino acids 89 to 252 (164 residues), 80 bits, see alignment E=2.5e-26

Best Hits

Swiss-Prot: 98% identical to LIPA_ENT38: Lipoyl synthase (lipA) from Enterobacter sp. (strain 638)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 100% identity to enc:ECL_03067)

MetaCyc: 97% identical to lipoyl synthase (Escherichia coli K-12 substr. MG1655)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>EX28DRAFT_2335 lipoate synthase (Enterobacter asburiae PDN3)
MSKPIVMERGVKYRDADKMALIPVKNVATEREALLRKPEWMKIKLPADSSRIQGIKAAMR
KNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDANEPQKLA
QTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIREKSPNIKIETLVPDFRGRMDRAL
DILTATPPDVFNHNLENVPRLYRQVRPGADYNWSLKLLERFKEAHPHIPTKSGLMVGLGE
TNDEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPDEFDEMKAEAMAMGFTHAA
CGPFVRSSYHADMQAKGEEVK