Protein Info for EX28DRAFT_2333 in Enterobacter asburiae PDN3

Annotation: lipoate-protein ligase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 TIGR00214: lipoyl(octanoyl) transferase" amino acids 27 to 204 (178 residues), 257.5 bits, see alignment E=3e-81 PF21948: LplA-B_cat" amino acids 28 to 197 (170 residues), 116.2 bits, see alignment E=9.8e-38

Best Hits

Swiss-Prot: 91% identical to LIPB_ENT38: Octanoyltransferase (lipB) from Enterobacter sp. (strain 638)

KEGG orthology group: K03801, lipoyl(octanoyl) transferase [EC: 2.3.1.181] (inferred from 95% identity to enc:ECL_03065)

MetaCyc: 84% identical to lipoyl(octanoyl) transferase (Escherichia coli K-12 substr. MG1655)
Lipoyl(octanoyl) transferase. [EC: 2.3.1.181]; RXN0-1138 [EC: 2.3.1.181]

Predicted SEED Role

"Octanoate-[acyl-carrier-protein]-protein-N-octanoyltransferase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.181

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (213 amino acids)

>EX28DRAFT_2333 lipoate-protein ligase B (Enterobacter asburiae PDN3)
MYQDKILVRHLGLQPYEPVSQAMHDFTDSRDDSTPDEIWLVEHLPVFTQGQAGKAEHLLM
TGDIPVIQSDRGGQVTYHGPGQQVMYVMLNLKRRKLGVRELVTLLEQTVVNTLAEYGIDA
HPRADAPGVYVGEMKICSLGLRIRKGCSFHGLALNINMDLAPFQRINPCGYAGMEMTQVR
QWVETATPETIRPVLLKNVLALLNNPPHEYIPA