Protein Info for EX28DRAFT_2289 in Enterobacter asburiae PDN3

Annotation: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF07819: PGAP1" amino acids 17 to 153 (137 residues), 42.2 bits, see alignment E=2.1e-14 PF00561: Abhydrolase_1" amino acids 18 to 241 (224 residues), 86 bits, see alignment E=8.6e-28 PF12146: Hydrolase_4" amino acids 18 to 112 (95 residues), 36.8 bits, see alignment E=6.9e-13 PF05057: DUF676" amino acids 19 to 100 (82 residues), 21.1 bits, see alignment E=5e-08 PF12697: Abhydrolase_6" amino acids 19 to 246 (228 residues), 72.7 bits, see alignment E=1.8e-23

Best Hits

Swiss-Prot: 81% identical to YBFF_ECOLI: Esterase YbfF (ybfF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to enc:ECL_03029)

Predicted SEED Role

"Esterase ybfF (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>EX28DRAFT_2289 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) (Enterobacter asburiae PDN3)
MKLNTRAQTAQSPNNNSPIVLVHGLFGSLDNLGVLARDLVTDHDILQVDMRNHGLSGRSD
EMTYAAMAQDLLDTLDAHDLQKVTLIGHSMGGKAVMALTALAPDRISGLVVIDVAPVDYD
VRRHDEIFAAINAVTEAGVATRQQAAAVMREHLNEEGVVQFLLKSFVDGQWRFNVPVLWE
QYNNIVGWETVPAWPHPTLFIRGGNSPYVTDAYRDTLLTQFPQARAHVIAGAGHWVHAEK
PDAVLRAIRRYLADTAN