Protein Info for EX28DRAFT_2262 in Enterobacter asburiae PDN3

Annotation: Transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF00392: GntR" amino acids 7 to 69 (63 residues), 84.5 bits, see alignment E=3.3e-28 PF07702: UTRA" amino acids 91 to 229 (139 residues), 120.5 bits, see alignment E=4.8e-39

Best Hits

Swiss-Prot: 73% identical to MNGR_ECOLI: Mannosyl-D-glycerate transport/metabolism system repressor MngR (mngR) from Escherichia coli (strain K12)

KEGG orthology group: K11922, GntR family transcriptional regulator, mannosyl-D-glycerate transport/metabolism system repressor (inferred from 93% identity to enc:ECL_03002)

Predicted SEED Role

"Mannosyl-D-glycerate utilization repressor MngR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>EX28DRAFT_2262 Transcriptional regulators (Enterobacter asburiae PDN3)
MGNKPMYRQIADALREKINAGELKPGDALPTESSLQEAFNVSRVTVRQALKLLTEEQIVE
SIQGSGTYVKEERVNYDIYQLTGFYEKLADRNVDTHSDVSVFEVVKADERLAARLAINPD
DKVWHVKRVRFIKQKPVNLEETWMPLAMFPDLTWEVMENSKYHYVEQIKKLVIDRSEQEL
VPIMPSEEAIAALSLDPAKPILEKVSRGFLKDGRVFEYSRNVFNTDDYKFTLVAKRRQ