Protein Info for EX28DRAFT_2202 in Enterobacter asburiae PDN3

Annotation: Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthases and related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13091: PLDc_2
  • amino acids 26 to 152 (127 residues), 51 bits, E=2e-17
  • amino acids 213 to 339 (127 residues), 105.6 bits, E=2.8e-34
• PF00614: PLDc
  • amino acids 109 to 132 (24 residues), 29.8 bits, see alignment (E = 6.7e-11)

Best Hits

Swiss-Prot: 83% identical to CLSB_SALTI: Cardiolipin synthase B (clsB) from Salmonella typhi

KEGG orthology group: K06132, putative cardiolipin synthase [EC: 2.7.8.-] (inferred from 96% identity to enc:ECL_02946)

MetaCyc: 81% identical to cardiolipin synthase B (Escherichia coli K-12 substr. MG1655)
CARDIOLIPSYN-RXN [EC: 2.7.8.41]; RXN0-7272 [EC: 2.7.8.41]

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (11/12 steps found)
• cardiolipin biosynthesis I (3/3 steps found)
• cardiolipin biosynthesis II (3/3 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• cardiolipin biosynthesis III (2/3 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Glycerophospholipid metabolism
• High-mannose type N-glycan biosynthesis
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.- or 2.7.8.41

Protein Sequence (412 amino acids)

>EX28DRAFT_2202 Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthases and related enzymes (Enterobacter asburiae PDN3)
MKCSWQEGNRITLLVNGDEYYPAVFKAIDNAQQKVILETFIWFEDNVGKQLHSVLLRAAR
RGVKIEVLLDGYGSPDLSDAFVNELTSAGVVFRYYDPGPRLFGMRTNLFRRMHRKIVVVD
ETVAFVGGINYSAEHMSDYGPEAKQDYAIRIEGPVVQDILLFELENLPGKEAVRRWWRRR
HRPEENRKPGEAQALFVWRDNGEHRDDIERHYLKMLANAKREVIIANAYFFPGYRLLHAM
RNAARRGVRVKLIVQGEPDMPIVKVGARLLYNYLVKGGVQIYEYRRRPLHGKVALMDDHW
ATVGSSNLDPLSLSLNLEANLIIHDRQFNQTLRDNLQALIVNDSVRVDESMVPKRTWWNL
GISVVVFHFLRHFPAMVGWLPAHTPKLAQVDPPVQPEMETQDRIEAEDGGKP