Protein Info for EX28DRAFT_2196 in Enterobacter asburiae PDN3

Annotation: Multidrug resistance efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF25917: BSH_RND" amino acids 42 to 230 (189 residues), 35.6 bits, see alignment E=1.3e-12 PF25881: HH_YBHG" amino acids 74 to 203 (130 residues), 204.5 bits, see alignment E=1.3e-64 PF25954: Beta-barrel_RND_2" amino acids 239 to 326 (88 residues), 26.3 bits, see alignment E=1.4e-09

Best Hits

Swiss-Prot: 90% identical to Y1286_ENT38: UPF0194 membrane protein Ent638_1286 (Ent638_1286) from Enterobacter sp. (strain 638)

KEGG orthology group: K01993, HlyD family secretion protein (inferred from 97% identity to enc:ECL_02940)

Predicted SEED Role

"Predicted membrane fusion protein (MFP) component of efflux pump, membrane anchor protein YbhG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>EX28DRAFT_2196 Multidrug resistance efflux pump (Enterobacter asburiae PDN3)
MKKPVAIILVVVVLLAAGVGGWLWYQSHQDKGLTLYGNVDIRTVNMSFRVGGRLASLSVD
EGDAIKSGQTLGMLDKAPYENALLQAKAGVSVAQAQYDLMLAGYRDEEIAQAAAAVKQAQ
AAYDYAQNFYARQQGLWKSRTISANDLENARSSRDQAQATLKSAQDKLSQYHTGNRPQDI
AQAKASLEQAQAQLAQAELDLHDTTLIAPSDGMLMTRAVEPGSMLSAGSTVLTLSLTRPV
WVRAYVDEPNLGQMQPGRELLLYTDGRPDKPYHGKVGFVSPTAEFTPKTVETPDLRTDLV
YRLRIIVTDADDALRQGMPVTVKVDSGERHE