Protein Info for EX28DRAFT_2184 in Enterobacter asburiae PDN3

Annotation: Protein of unknown function (DUF1471)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 88 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF07338: YdgH_BhsA-like" amino acids 36 to 88 (53 residues), 66.3 bits, see alignment E=9.8e-23

Best Hits

Swiss-Prot: 61% identical to MCBA_ECOLI: Uncharacterized protein McbA (mcbA) from Escherichia coli (strain K12)

KEGG orthology group: K13650, MqsR-controlled colanic acid and biofilm protein A (inferred from 93% identity to enc:ECL_02926)

Predicted SEED Role

"FIG00626108: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (88 amino acids)

>EX28DRAFT_2184 Protein of unknown function (DUF1471) (Enterobacter asburiae PDN3)
MKKYLTLAVIAAALATASFSAMAVQSLTQSTDTSQLRPAGTVSVSRASNLDDLQAKLAEK
ARQEGAKGFVVNSAGGDNHMYGTATIYK