Protein Info for EX28DRAFT_2182 in Enterobacter asburiae PDN3

Annotation: Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 737 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 140 to 162 (23 residues), see Phobius details amino acids 182 to 205 (24 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 264 to 286 (23 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details amino acids 335 to 364 (30 residues), see Phobius details amino acids 376 to 396 (21 residues), see Phobius details amino acids 426 to 446 (21 residues), see Phobius details amino acids 466 to 488 (23 residues), see Phobius details amino acids 509 to 530 (22 residues), see Phobius details amino acids 536 to 555 (20 residues), see Phobius details PF25392: MS_channel_TM1" amino acids 376 to 454 (79 residues), 86.4 bits, see alignment E=2.2e-28 PF21088: MS_channel_1st" amino acids 516 to 556 (41 residues), 41.9 bits, see alignment 1.6e-14 PF00924: MS_channel_2nd" amino acids 557 to 621 (65 residues), 65.4 bits, see alignment E=7.9e-22 PF21082: MS_channel_3rd" amino acids 628 to 715 (88 residues), 41.6 bits, see alignment E=2.7e-14

Best Hits

Swiss-Prot: 81% identical to YBIO_ECOLI: Moderate conductance mechanosensitive channel YbiO (ybiO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to enc:ECL_02923)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (737 amino acids)

>EX28DRAFT_2182 Small-conductance mechanosensitive channel (Enterobacter asburiae PDN3)
MPWILLLLISLFSAPSFAVAIPGVTTGNTATQQSTPPPEPDVEQKKAAYGALADVLENDT
SRQELIGQLRKAAATPPQESVPTLTPPQVEEQKTVLENVTDVSRHYGEALSSRFAQLYRN
LIGSPHKAFNPQTFTAAATQFLMLAGAVFFFYWLVRLCAWPLYRKMGQWGRRKNQQKSSW
LHLPLMIASAFIIDLLLLALTLFLGQMLADRLNAGNKTIAFQQSLFLNAFALIEFFKALL
RLLFCPHVPELRPFSIRDASAKYWALRLSVLSGLIGYGLLVAVPIISNQVNVQFGALANV
LIMICITVWSLYLIFHNKKTITQSLLNLADRSLSFFSLFIRAFALVWHWLASAYFIVLCF
FSLFDPGNSLKFMMGATFKSLAIIGIAAFVSGLLSRWISKTITLSPQVQRNYPELQKRVN
GWMSVSLKVARILTVCVAIMLLLNAWSLFDFWNWLHNGAGEKTVDILIRIALILFFSAVG
WTLLASLIENRLVSDIHGRPLPSARARTLLTLFRNALAVIISTITIMIVLSEIGVNIAPL
LAGAGALGLAISFGSQTLVKDIITGIFIQFENGMNTGDLVTIGPLTGTVERMSIRSVGVR
QDTGAYHIIPWSSITTFANFVRGIGSVVANYDVDRHEDADKAKQALRDAVEELMEMKDIR
GLVIGEPSFAGIVGLTNTAFTLRVSFTTQPLKQWTVRFALDSMVKKHFDLANVRMPVQTY
QVLPPPASPLPPQEPTL