Protein Info for EX28DRAFT_2159 in Enterobacter asburiae PDN3

Annotation: P pilus assembly protein, porin PapC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 838 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF13954: PapC_N" amino acids 42 to 187 (146 residues), 127.7 bits, see alignment E=5.5e-41 PF00577: Usher" amino acids 204 to 752 (549 residues), 570.1 bits, see alignment E=9.5e-175 PF13953: PapC_C" amino acids 764 to 819 (56 residues), 47.1 bits, see alignment 2.6e-16

Best Hits

Swiss-Prot: 50% identical to YFCU_ECOLI: Putative outer membrane usher protein YfcU (yfcU) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 75% identity to ent:Ent638_0403)

Predicted SEED Role

"FIG027785: Fimbriae usher protein StfC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (838 amino acids)

>EX28DRAFT_2159 P pilus assembly protein, porin PapC (Enterobacter asburiae PDN3)
MANMANLKIKNELGARMAKWSVLAACVFIYCHGTVKAADDIQFNTDVLDVKDKVNIDLSH
FSKRGYIMPGDYTFKIKINQNELDEQPIAVYAAEGDNTDSKVCFTPDVVSKMGFKADSEK
AFTFWHNNQCVDITTLKGVMVNPDLSAGVLTINVPQAYVEYSDDNWVPSSMWDEGVPGLL
ADYNLNAQARQNQHGSDDDSVSGNGTFGANLGAWRARADWQTNYDDSTDGENGSGQKTWS
WSRVYLYRALTALKAKLTLGEDYLNSDLFDSFRFAGASVVSDDNMLPPNLRGYAPEVTGV
AKTNAKVTISQQGRVIYETQVAAGPFAIQDLNNAVAGMLDVRVQEQDGSVQTFKVSTASI
PYLTRPGSVRYKVFAGKPTSYDHSTEGDTFGSGEFSWGISNGWSLYGGAVSSNDYLSLAA
GIGRDLMVLGALSFDVTRSDAKLDEEDRHGQSYRVSYSKRFDETDSQVTFAGYRFSEKNY
MSFNDYLNYKTNNDDFMQGKEMYTATFSQQFKSLGLSAYLNYAHQTYWNTPTEDRYNLSL
SRFFDIGKWKNINGSLTAYRNKFNGENDDGMYLSFSVPWGESGSLSYNGSVNGDSNSHNL
AYFDHLKNGDNYRIAAGGSDDGGTLSGYYDHTADVADITANVDYQQNQYTSAGLSLRGGM
TATTHGAALHRSNNLGGTRVMVDTGDAVDIPVQGYSDSTRTNRFGKAVITEVSDYNKNNL
SIDINDLPDNAEASSSVVQATLTEGAIGYRKFNVISGEKAMGVIRLADSSYPPFGASVQN
AEKQEIGIVNDEGQTYLSGLKPGAKLNVSWDGEVQCAVTVPEKLSGLNQNGNLLLPCQ