Protein Info for EX28DRAFT_2150 in Enterobacter asburiae PDN3

Annotation: PTS system, lactose/cellobiose family IIC component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 37 to 61 (25 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 238 to 261 (24 residues), see Phobius details amino acids 294 to 318 (25 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 353 to 376 (24 residues), see Phobius details amino acids 378 to 399 (22 residues), see Phobius details amino acids 406 to 425 (20 residues), see Phobius details TIGR00410: PTS system, lactose/cellobiose family IIC component" amino acids 19 to 434 (416 residues), 310.6 bits, see alignment E=9.4e-97 PF02378: PTS_EIIC" amino acids 34 to 363 (330 residues), 158.4 bits, see alignment E=1.2e-50

Best Hits

KEGG orthology group: K02761, PTS system, cellobiose-specific IIC component (inferred from 97% identity to enc:ECL_02906)

Predicted SEED Role

"PTS system, cellobiose-specific IIC component (EC 2.7.1.69)" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>EX28DRAFT_2150 PTS system, lactose/cellobiose family IIC component (Enterobacter asburiae PDN3)
MSETKITPHMQSFVDKFVEFSARLANQVHLRSLRDAFATVMPIFILAGLAVLVNNVVFPW
IFHGDTLAQFKVWGEAIINGTLNIAALLLAPMIAWSLARNKDFDNPVSAVVIAVSSFIIM
MPMRLQITPVGSDAAVNVTQVLTFANIGSTGIFAGVLIGLLSTELFIAISRLKALHISLG
ENVPPAVSKSFTALIPTILTLSLFAVLAAVLANVLHTDLIHLITTFIQQPLRLINTSLPG
TIFIYSFGNFLFTLGIHQSVVNSVVLEPFLLINTNENMLAFANGQPIPHIINNIFVPTFG
MVGGTGSTISLLIAIFIFSRQKSAKQVARLSLAPGLFNINEPVIFGLPIVFNLPLMIPFV
LLPAVGIYFAWLCTTLGLMSRCVVMIPWTTPPILSAWLATAGDWRAVVVQLAIIVFGVFF
YLPFLKIAERVALKNSGIEN