Protein Info for EX28DRAFT_2142 in Enterobacter asburiae PDN3

Annotation: HAD-superfamily hydrolase, subfamily IIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF05116: S6PP" amino acids 4 to 241 (238 residues), 48 bits, see alignment E=1.9e-16 TIGR00099: Cof-like hydrolase" amino acids 5 to 259 (255 residues), 192.5 bits, see alignment E=1e-60 PF08282: Hydrolase_3" amino acids 6 to 259 (254 residues), 172.4 bits, see alignment E=2.4e-54 TIGR01484: HAD hydrolase, family IIB" amino acids 6 to 232 (227 residues), 66.7 bits, see alignment E=3.1e-22

Best Hits

Swiss-Prot: 81% identical to SUPH_ECOLI: Sugar phosphatase YbiV (ybiV) from Escherichia coli (strain K12)

KEGG orthology group: K07757, sugar-phosphatase [EC: 3.1.3.23] (inferred from 94% identity to enc:ECL_02897)

MetaCyc: 81% identical to sugar phosphatase YbiV (Escherichia coli K-12 substr. MG1655)
Sugar-phosphatase. [EC: 3.1.3.23]

Predicted SEED Role

"HMP-PP hydrolase (pyridoxal phosphatase) Cof, detected in genetic screen for thiamin metabolic genes (PMID:15292217)"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>EX28DRAFT_2142 HAD-superfamily hydrolase, subfamily IIB (Enterobacter asburiae PDN3)
MTVKVIVTDMDGTFLDDAKQYDRDRFQAQFDQLKARDIEFVVASGNQYYQLISFFPELKD
RISFVAENGALVFDRGEQIFHGELTRHESQIVIGELLKDKGLNFVACGLESAWVSDQAPE
EFVALMSKHYHRLKRISDYREIDDVLFKFSLNLPDSDIPNLVDKLHVSLDGIMKPVTSGF
GFVDLIIPGLHKANGISRLLKRWKISPQECVAIGDSGNDAEMLKLVKYSFAMGNAAESIK
EISRYGTDDNNHQGALNVIQAVLDNHSPFDL