Protein Info for EX28DRAFT_2138 in Enterobacter asburiae PDN3

Annotation: molybdopterin synthase sulfurylase MoeB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details TIGR02355: molybdopterin synthase sulfurylase MoeB" amino acids 9 to 248 (240 residues), 423.4 bits, see alignment E=1.1e-131 PF00899: ThiF" amino acids 13 to 247 (235 residues), 250.4 bits, see alignment E=1.4e-78

Best Hits

Swiss-Prot: 84% identical to MOEB_SALTY: Molybdopterin-synthase adenylyltransferase (moeB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K11996, adenylyltransferase and sulfurtransferase (inferred from 91% identity to enc:ECL_02893)

MetaCyc: 84% identical to molybdopterin-synthase adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11361 [EC: 2.7.7.80]

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeB" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>EX28DRAFT_2138 molybdopterin synthase sulfurylase MoeB (Enterobacter asburiae PDN3)
MTVELSDPEMMRYNRQIVLRGFDFEGQEALKAASVLVVGLGGLGCAAAQYLAAAGVGRMT
LLDFDTVSVSNLQRQTLHSDATVGQPKVDSARSALARINPNGQFTLIDAMLDDDALSAQI
AQHDLVLDCTDNVAVRNQLNAACFAHKIPLVSGAAIRMEGQISVFTYAEGEPCYRCLSRL
FGENALTCVEAGVMAPLVGVIGSLQAMEAIKVLAHYGTPAAGKIVMYDAMTCQFREMKLM
RNPGCEVCGG