Protein Info for EX28DRAFT_2124 in Enterobacter asburiae PDN3

Annotation: PAP2 (acid phosphatase) superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 83 to 100 (18 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details PF01569: PAP2" amino acids 107 to 237 (131 residues), 45.7 bits, see alignment E=2.7e-16

Best Hits

KEGG orthology group: None (inferred from 82% identity to ent:Ent638_1333)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>EX28DRAFT_2124 PAP2 (acid phosphatase) superfamily protein (Enterobacter asburiae PDN3)
MALTSSRSELSNLQTNKTKRLYRLPTRFYGYQLFVLIALAVLFTWLSRNEALDRWITGFW
YDAATQTFPLQKDHLLDLLNHRLAKYIAIALGAVALFYGAYKRNARLVTAALLMGVGALV
VGVLKSVSHHSCPWDLVEYGGKAMSYPLFSAVPADSGPGRCFPGGHASSGFMVMGLFFAF
WRERPRLAWCFVALGVVLGLAMGYGQVMRGAHFFSHNLWAGWWVWFSQVVVYGLISTRFA
KE