Protein Info for EX28DRAFT_2101 in Enterobacter asburiae PDN3

Annotation: alpha-L-glutamate ligase, RimK family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF18030: Rimk_N" amino acids 9 to 101 (93 residues), 135.4 bits, see alignment E=2.1e-43 TIGR00768: alpha-L-glutamate ligase, RimK family" amino acids 9 to 293 (285 residues), 317.5 bits, see alignment E=3.8e-99 PF02655: ATP-grasp_3" amino acids 104 to 270 (167 residues), 36.7 bits, see alignment E=1.3e-12 PF08443: RimK" amino acids 104 to 293 (190 residues), 271.7 bits, see alignment E=9.2e-85 PF02955: GSH-S_ATP" amino acids 123 to 269 (147 residues), 62.1 bits, see alignment E=1.4e-20 PF07478: Dala_Dala_lig_C" amino acids 140 to 274 (135 residues), 26.3 bits, see alignment E=1.5e-09

Best Hits

Swiss-Prot: 91% identical to RIMK_ENT38: Probable alpha-L-glutamate ligase (rimK) from Enterobacter sp. (strain 638)

KEGG orthology group: K05844, ribosomal protein S6 modification protein (inferred from 99% identity to enc:ECL_02821)

MetaCyc: 88% identical to ribosomal protein S6 modification protein (Escherichia coli K-12 substr. MG1655)
6.3.2.-

Predicted SEED Role

"Ribosomal protein S6 glutaminyl transferase" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>EX28DRAFT_2101 alpha-L-glutamate ligase, RimK family (Enterobacter asburiae PDN3)
MSSERCRVKIAILSRDGTLYSCKRLREAAAKRGHQVEILDPMSCYMNIDPAASSIHYKGR
KLPHFDAVIPRIGSQITYYGTAALRQFEMLGSYPLNESVAISRARDKLRSLQLLARQGID
LPVTGIAHSPDDTSDLIDMVGGAPLVIKLVEGTQGIGVVLAETRQAAESVIDAFRGLNAH
ILVQEYIEEAKGRDIRCFVVGNEVVAAIERQAKEGDFRSNLHRGGVARVADISDREREIA
VKAAQTLGLDVAGVDLLRATRGPLVMEVNASPGLEGVEKTTGVDIAGKMIAWIERHATPG
YCLKTGG