Protein Info for EX28DRAFT_2071 in Enterobacter asburiae PDN3

Annotation: Type II secretory pathway, component PulL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 242 to 265 (24 residues), see Phobius details PF05134: T2SSL" amino acids 8 to 227 (220 residues), 125.2 bits, see alignment E=2.7e-40 PF12693: GspL_C" amino acids 241 to 372 (132 residues), 47.8 bits, see alignment E=1.4e-16

Best Hits

KEGG orthology group: K02461, general secretion pathway protein L (inferred from 66% identity to enc:ECL_02790)

Predicted SEED Role

"General secretion pathway protein L"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>EX28DRAFT_2071 Type II secretory pathway, component PulL (Enterobacter asburiae PDN3)
MKIMKKVLFIRPDTREDGKIWWCESGNDRVEYLTGWSALSELSCHPLSQQVCLLLPASET
IFRHFTLPKKGLSAQTAQFSWMAEETLLGEVETLHWTVLNKKGPEVDAVAIDAERLRHWL
ELFAQAGLTVVQALPDAWLLPVSEGGTTLVSLEESYWLRFSPGSAGEADTVLLPLLLSKC
PAGEVCCYGDVPQEVQVDERLAWQHPLVLIQPQWKGCRINMLHGEFSGRSASGPRFRHAK
KALAAAALLCVGLLIGPRVGMAWMLTHQQNEIHREMTTVAQHYFPTLRQTSNLKYYVGQN
ISKAKKGVFLQLEALNQIRQSLPSLEINNVEYDETQNQLTLNVKSMDKQTLQDFVARSAE
TFEFTMQPISGEAPYTAIITGSYK