Protein Info for EX28DRAFT_2059 in Enterobacter asburiae PDN3

Annotation: hydroxylamine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 493 to 509 (17 residues), see Phobius details PF03063: Prismane" amino acids 1 to 542 (542 residues), 500.4 bits, see alignment E=3e-154 TIGR01703: hydroxylamine reductase" amino acids 1 to 545 (545 residues), 762.3 bits, see alignment E=1.2e-233

Best Hits

Swiss-Prot: 94% identical to HCP_ENT38: Hydroxylamine reductase (hcp) from Enterobacter sp. (strain 638)

KEGG orthology group: K00378, hydroxylamine reductase [EC: 1.7.-.-] (inferred from 96% identity to enc:ECL_02778)

MetaCyc: 93% identical to protein S-nitrosylase (Escherichia coli K-12 substr. MG1655)
Hydroxylamine reductase. [EC: 1.7.99.1]

Predicted SEED Role

"Hydroxylamine reductase (EC 1.7.-.-)" in subsystem Nitrosative stress (EC 1.7.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.- or 1.7.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>EX28DRAFT_2059 hydroxylamine reductase (Enterobacter asburiae PDN3)
MFCVQCEQTIRTPAGNGCSYAQGMCGKTAETSDLQDLLIAALQGLSAWAFKAREYGIVDH
YVDSFAPRAFFSTLTNVNFDSPRMVGYAREAIALREALKAQCLKADAGARVENPMSELQL
VSGDLQRQAAEFTPNKDKAAIGENILGLRLLCLYGLKGAAAYMEHAHVLGQYDNEIYAQY
HKIMAWLGTWPADMNALLECSMEIGQMNFRVMSILDAGETSTYGHPTPTQVNVKATEGKC
ILISGHDLQDLYNLLKQTEGTGVNVYTHGEMLPAHGYPELRKFKHLIGNYGSGWQNQQVE
FARFPGPIVMTSNCIIDPTVGAYDDRIWTRSIVGWPGVSHLEGDDFGPVIAQAQQMAGFP
YSEIPHLITVGFGRETLLGAADSLIDLVSREKLRHIFLVGGCDGARGERNYFTDFATSVP
EDCLILTLACGKYRFNKLDFGGIEGLPRLIDAGQCNDAYSAIILAVTLAEKLGCGVNDLP
LSLVLSWFEQKAIVILLTLLSLGVTNIVTGPTAPGFLTPDLLAVLNEKFGLRSVTNVEDD
MKQLLSA