Protein Info for EX28DRAFT_2021 in Enterobacter asburiae PDN3

Annotation: lipid-A-disaccharide kinase (EC 2.7.1.130)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details PF02606: LpxK" amino acids 13 to 318 (306 residues), 392.7 bits, see alignment E=6.5e-122 TIGR00682: tetraacyldisaccharide 4'-kinase" amino acids 19 to 321 (303 residues), 368.5 bits, see alignment E=1.4e-114

Best Hits

Swiss-Prot: 83% identical to LPXK_CITK8: Tetraacyldisaccharide 4'-kinase (lpxK) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 92% identity to enc:ECL_02739)

MetaCyc: 79% identical to tetraacyldisaccharide 4'-kinase (Escherichia coli K-12 substr. MG1655)
Tetraacyldisaccharide 4'-kinase. [EC: 2.7.1.130]

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>EX28DRAFT_2021 lipid-A-disaccharide kinase (EC 2.7.1.130) (Enterobacter asburiae PDN3)
MIARIWSGESPLWLLLLPLSWLYGLVSGAIRLLYRLGLKRAWRAPVPVVVVGNLTAGGNG
KTPVVIWLVEQLQKRGIRPGVVSRGYGGKAARYPLLLTAETTTAEAGDEPVLIFQRTGAP
VAVSPVRSDAVQALLAEHAVQIIITDDGLQHYALARDKEIVVIDGVRRFGNGWWLPAGPM
RERASRLKSVDAVIVNGGEANAGEIPMYLQPGLAINLVTGERRSVAELPSPVAMAGIGHP
PRFFATLEQCGARLEKRVPLADHQALVEGQVDALTVPGQSLIMTEKDAVKCRAFAKDNWW
YLPVDAELSGEQPEHLLQELIALVQ