Protein Info for EX28DRAFT_2020 in Enterobacter asburiae PDN3

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF06224: AlkZ-like" amino acids 38 to 381 (344 residues), 261.4 bits, see alignment E=8.9e-82

Best Hits

Swiss-Prot: 78% identical to YCAQ_ECOLI: Uncharacterized protein YcaQ (ycaQ) from Escherichia coli (strain K12)

KEGG orthology group: K09927, hypothetical protein (inferred from 92% identity to enc:ECL_02738)

MetaCyc: 78% identical to interstrand DNA crosslink repair glycosylase (Escherichia coli K-12 substr. MG1655)
3.2.2.-; 3.2.2.-

Predicted SEED Role

"FIG004798: Putative cytoplasmic protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>EX28DRAFT_2020 Uncharacterized protein conserved in bacteria (Enterobacter asburiae PDN3)
MSLPQLSLSAARHLHLAAQGLLKKPRRLAQPADILSTVQRMSLLQIDTINIVARSPYLVL
FSRLGNYPSQWLDEALSKGELMEYWAHEACFLPRSDFALVRHRMLAPEKMGWKYRQAWML
EHAAEIEQLIAHIQDNGPVRSADFEHPRKGTSGWWEWKPHKRHLEGLFTSGKVMVIERRN
FQRVYDLTHRVMPHWDDERDLLTQEAAEAIMLENSARSLGIFRTQWLADYYRLRQPALKP
LLDIWQCEQRVIPVTVETLGEMWLHADLLPLLPQALEGKLQATHSAVLSPFDPVVWDRKR
AEQLFDFSYRLECYTPAPKRQYGYFVLPLLHKGQLVGRMDAKMHRKTGTLEIIALYLEEG
IRVTASLEKGLTSAISEFARWQGARDVTLGRVPDGLFTTCRSGWETGTP