Protein Info for EX28DRAFT_2003 in Enterobacter asburiae PDN3

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00005: ABC_tran" amino acids 27 to 160 (134 residues), 106 bits, see alignment E=1.3e-34

Best Hits

Swiss-Prot: 88% identical to SSUB_ECOUT: Aliphatic sulfonates import ATP-binding protein SsuB (ssuB) from Escherichia coli (strain UTI89 / UPEC)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 90% identity to enc:ECL_02706)

MetaCyc: 86% identical to aliphatic sulfonate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>EX28DRAFT_2003 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component (Enterobacter asburiae PDN3)
MNTARLNQGTPLLLNGVTKRYGENTILNGLDLHIPAGQFVAVVGRSGGGKSTLLRLLAGL
EAPNGGDILAGTTPLSNIQDDTRMMFQDARLLPWKTVIDNVGLGLKGSWREEARQALAAV
GLENRAGEWPAALSGGQKQRVALARALIHHPGLLLLDEPLGALDALTRIEMQDLIGSLWQ
AHGFTVLLVTHDVSEAVAMADRVLLIEDGKIGLDLTVDLPRPRRVGSARLAELEAEVLDR
VMKRGGTELERAKANA