Protein Info for EX28DRAFT_1985 in Enterobacter asburiae PDN3

Annotation: cell division inhibitor SulA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 TIGR00623: cell division inhibitor SulA" amino acids 21 to 187 (167 residues), 305.7 bits, see alignment E=3.9e-96 PF03846: SulA" amino acids 49 to 138 (90 residues), 167 bits, see alignment E=4.7e-54

Best Hits

Swiss-Prot: 83% identical to SULA_ENT38: Cell division inhibitor SulA (sulA) from Enterobacter sp. (strain 638)

KEGG orthology group: K13053, cell division inhibitor SulA (inferred from 94% identity to enc:ECL_02688)

Predicted SEED Role

"Cell division inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>EX28DRAFT_1985 cell division inhibitor SulA (Enterobacter asburiae PDN3)
MHTGVTVYPYSNYRAGMNMHTSGYANRSTSLSSTAGNVAQNSVERVSTGLISEVVYREDQ
PLLTQLLLLPLLQQLGQQSRWQLWLTPQQKLSREWVQSAGLPLTKVMQINQLPPCDTVES
MIRALRTGNYSVVIGWLPEELTEEEHFRLTEAAEEGSAIGFIMRPVRSDSYRRGQLSGLK
IHSNLYH