Protein Info for EX28DRAFT_1983 in Enterobacter asburiae PDN3

Annotation: TIGR01666 family membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 720 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 40 to 57 (18 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 389 to 408 (20 residues), see Phobius details amino acids 414 to 431 (18 residues), see Phobius details amino acids 438 to 458 (21 residues), see Phobius details amino acids 464 to 480 (17 residues), see Phobius details amino acids 487 to 503 (17 residues), see Phobius details amino acids 509 to 531 (23 residues), see Phobius details TIGR01666: TIGR01666 family membrane protein" amino acids 8 to 706 (699 residues), 1146.6 bits, see alignment E=0 TIGR01667: integral membrane protein, YccS/YhfK family" amino acids 8 to 705 (698 residues), 1042.4 bits, see alignment E=0 PF12805: FUSC-like" amino acids 66 to 345 (280 residues), 378.4 bits, see alignment E=2.8e-117 PF13515: FUSC_2" amino acids 405 to 525 (121 residues), 100.5 bits, see alignment E=1.2e-32 PF04632: FUSC" amino acids 410 to 685 (276 residues), 33.8 bits, see alignment E=2.5e-12

Best Hits

Swiss-Prot: 82% identical to YCCS_ECOLI: Inner membrane protein YccS (yccS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to enc:ECL_02686)

Predicted SEED Role

"Putative efflux (PET) family inner membrane protein YccS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (720 amino acids)

>EX28DRAFT_1983 TIGR01666 family membrane protein (Enterobacter asburiae PDN3)
MLSPLLRRYTWNSTWLYNVRIFIALCGTVALPWWLNDVKLTIPLTLGVVAGALADLDDRL
AGRLRNLVITLVCFFIASASVELLFPWPWLFALGLTLSTSGFILLGGLGQRYATIAFGAL
LIAIYTMLGVSLYDQWYQQPVLLLLGAIWYNLLTLTGHLIFPVRPLQDNLARSFEQLAHY
LELKSRLFDPDIEEESQAPLYDLALANGQLVATLNQTKASLLTRLRGDRGQRGTRRTLHY
YFAAQDIHERASSSHVQYAALREKFRYSDVMFRFQRLLSMQSQACQQLSRSILLRTPYQH
DPRFERVFSHLDAALDRVQASGTSTEHIKALGFLLNNLRAIDAQLATIESEQAMALPGSE
VENQLADDSVHSVSDMWLRLSRNFTPESALFRHAVRMSLVLCVGYAFIQITGLHHGYWIL
LTSLFVCQPNYNATRHRLALRIIGTLVGVAIGLPVLYFVPSVEGQLILIVITGVLFFAFR
NVQYAHATMFITLLVLLCFNLLGEGFEVALPRVIDTLIGCAIAWAAVSFIWPDWRFRNLP
RVVDRAMNANCRYLDAILEQYHQGRDNRLAYRIARRDAHNSDAELASVVSNMSTEPRATA
EIRETAFRLLCLNHTFTSYISTLGAHREKLTNPGILNLLDDAVCYVDDALHHRPADEPRV
QQALNELAQRIAHLDPGNDSKAPLVLQQIGLLIALLPEICRLQQQIATWRSDSPVAQAAH