Protein Info for EX28DRAFT_1968 in Enterobacter asburiae PDN3

Annotation: CS1 type fimbrial major subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04449: Fimbrial_CS1" amino acids 23 to 158 (136 residues), 122 bits, see alignment E=1.2e-39

Best Hits

KEGG orthology group: None (inferred from 88% identity to eae:EAE_19090)

Predicted SEED Role

"Alpha-fimbriae major subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>EX28DRAFT_1968 CS1 type fimbrial major subunit (Enterobacter asburiae PDN3)
MRKYFKPLMIVAAMTTSVSALAIQKDITVNASVDSQLDMTQADNTPLPASIDMQYLPGRG
LESYRLNTKVWSNSATSNVKVRLVSAAKLANADGAETIPMTVMLGDKTLSTADVEYTGTE
LFPGSIENGSAVLPLTISQTTKGILKTGQYSGVVSLMLTQATTTEGGA